PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g05570.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 400aa    MW: 42272.5 Da    PI: 6.6129
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g05570.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32109162255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Zjn_sc00014.1.g05570.1.am.mk 109 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 162
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-15107163IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-29107163IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23109162IPR006447Myb domain, plants
PfamPF002496.3E-8110161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MLRRNLPNLS LQISPPASSS DASTVAKPAP VEASTATYDD EGRGEVWLVF ANPSPSVEPP  60
DLSLELGTAA RADDVGRRSH LLQPHHGCAF KRAAERASVP GLKRSARAPR MRWTTALHAR  120
FVHAVELLGG HERATPKSVL ELMNVKDLTL AHVKSHLQMY RTVKSTDRSS HVTTGEALLE  180
QQRTATGMME VAVEAAAAAA EGGGRGVAAV LQRSDDMVGI CGPPAAAAAA ASAATTASAA  240
HFLCAPAPTP LMHPSSLFTC VYSSSRVGTD QGMHVPTLQS SAPEPFLRTD HAAVALEKGA  300
GIVDSLHPRQ SQNHSPGLQD PNQEVAAQEE VNGQMAAARL QHASVEAATN CSSPASSSPS  360
LASLELLADD MDAPNLEISL GRQDWKNMDR RPEELSLKYL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0649764e-77BT064976.1 Zea mays full-length cDNA clone ZM_BFc0084O11 mRNA, complete cds.
GenBankBT0651244e-77BT065124.1 Zea mays full-length cDNA clone ZM_BFb0205B22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466395.11e-102hypothetical protein SORBIDRAFT_01g007030
TrEMBLC5WZ981e-102C5WZ98_SORBI; Putative uncharacterized protein Sb01g007030
STRINGSb01g007030.11e-102(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.28e-43G2-like family protein